OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DHRS1 (NM_001136050) Human Mass Spec Standard

Be the first to review this product
SKU
PH327656
DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_001129522)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812489 DHRS1 mouse monoclonal antibody,clone OTI4C12 100 ul
$447.00
LY408602 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DHRS1 or NM_001136050"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227656
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC227656 protein sequence
Red=Cloning site Green=Tags(s)

MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE
VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP
AGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV
LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS
VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001129522
RefSeq Size 1495
RefSeq ORF 939
Synonyms SDR19C1
Locus ID 115817
UniProt ID Q96LJ7
Cytogenetics 14q12
Summary This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Nov 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DHRS1" proteins (7)
SKU Description Size Price
PH304206 DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461) 10 ug
$3,360.00
LC408602 Lyophilized DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427794 Lyophilized DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408602 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427794 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304206 Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2, 20 µg 20 ug
$867.00
TP327656 Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products