DHRS1 (NM_138452) Human Mass Spec Standard

SKU
PH304206
DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_612461)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204206]
Predicted MW 33.9 kDa
Protein Sequence
Protein Sequence
>RC204206 protein sequence
Red=Cloning site Green=Tags(s)

MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESE
VRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVP
AGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEV
LQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSS
VLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612461
RefSeq Size 1488
RefSeq ORF 939
Synonyms SDR19C1
Locus ID 115817
UniProt ID Q96LJ7
Cytogenetics 14q12
Summary This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:DHRS1 (NM_138452) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327656 DHRS1 MS Standard C13 and N15-labeled recombinant protein (NP_001129522) 10 ug
$3,255.00
LC408602 DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427794 DHRS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408602 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2 100 ug
$436.00
LY427794 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1 100 ug
$436.00
TP304206 Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327656 Recombinant protein of human dehydrogenase/reductase (SDR family) member 1 (DHRS1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.