OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CHORDC1 (NM_001144073) Human Mass Spec Standard

Be the first to review this product
SKU
PH327607
CHORDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001137545)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336847 Rabbit Polyclonal CHORDC1 Antibody
100 ul
$585.00
LY428496 Transient overexpression lysate of cysteine and histidine-rich domain (CHORD)-containing 1 (CHORDC1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "CHORDC1 or NM_001144073"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227607
Predicted MW 35.1 kDa
Protein Sequence
Protein Sequence
>RC227607 representing NM_001144073
Red=Cloning site Green=Tags(s)

MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGCTKGRHNSEKPPEPVKPEVKTTEKKELCELK
PKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDEIKIGTSCKN
GGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP
CRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATK
IEITMRKAEPMQWASLELPAAKKQEKQKDATTD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001137545
RefSeq ORF 939
Synonyms CHP1
Locus ID 26973
UniProt ID Q9UHD1
Cytogenetics 11q14.3
Summary Regulates centrosome duplication, probably by inhibiting the kinase activity of ROCK2. Proposed to act as co-chaperone for HSP90. May play a role in the regulation of NOD1 via a HSP90 chaperone complex. In vitro, has intrinsic chaperone activity. This function may be achieved by inhibiting association of ROCK2 with NPM1. Involved in stress response. Prevents tumorigenesis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CHORDC1" proteins (3)
SKU Description Size Price
LC428496 Lyophilized CHORDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY428496 Transient overexpression lysate of cysteine and histidine-rich domain (CHORD)-containing 1 (CHORDC1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP327607 Recombinant protein of human cysteine and histidine-rich domain (CHORD)-containing 1 (CHORDC1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products