OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAXX (NM_001141970) Human Mass Spec Standard

Be the first to review this product
SKU
PH327435
DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135442)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA305964 Rabbit Polyclonal Daxx Antibody
100 ug
$640.00
LY400540 Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "DAXX or NM_001141970"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227435
Predicted MW 82.7 kDa
Protein Sequence
Protein Sequence
>RC227435 representing NM_001141970
Red=Cloning site Green=Tags(s)

MRGSENCGEGRLERRFLSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKC
YKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYIN
ELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALY
VAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVN
RRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGC
HLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADT
PEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDE
EEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESN
GEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVS
PHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDS
PSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135442
RefSeq ORF 2256
Synonyms BING2; DAP6; EAP1; SMIM40
Locus ID 1616
UniProt ID B4E1C1
Cytogenetics 6p21.32
Summary This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. provided by RefSeq, Nov 2008
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Amyotrophic lateral sclerosis (ALS), MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DAXX" proteins (11)
SKU Description Size Price
PH319497 DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001341) 10 ug
$3,360.00
PH326603 DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135441) 10 ug
$3,360.00
LC400540 Lyophilized DAXX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427986 Lyophilized DAXX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427987 Lyophilized DAXX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400540 Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY427986 Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY427987 Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP319497 Recombinant protein of human death-domain associated protein (DAXX), transcript variant 2, 20 µg 20 ug
$867.00
TP326603 Recombinant protein of human death-domain associated protein (DAXX), transcript variant 1, 20 µg 20 ug
$867.00
TP327435 Recombinant protein of human death-domain associated protein (DAXX), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products