DAXX (NM_001141969) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC226603] |
Predicted MW | 81.4 kDa |
Protein Sequence |
Protein Sequence
>RC226603 protein sequence
Red=Cloning site Green=Tags(s) MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEF LELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAK KKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKEL DLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGP DTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGK DGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEE SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCK KSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001135441 |
RefSeq Size | 2632 |
RefSeq ORF | 2220 |
Synonyms | BING2; DAP6; EAP1; SMIM40 |
Locus ID | 1616 |
UniProt ID | Q9UER7 |
Cytogenetics | 6p21.32 |
Summary | This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), MAPK signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH319497 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001341) | 10 ug |
$3,255.00
|
|
PH327435 | DAXX MS Standard C13 and N15-labeled recombinant protein (NP_001135442) | 10 ug |
$3,255.00
|
|
LC400540 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC427986 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC427987 | DAXX HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400540 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 2 | 100 ug |
$665.00
|
|
LY427986 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 1 | 100 ug |
$665.00
|
|
LY427987 | Transient overexpression lysate of death-domain associated protein (DAXX), transcript variant 3 | 100 ug |
$665.00
|
|
TP319497 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP326603 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP327435 | Recombinant protein of human death-domain associated protein (DAXX), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.