OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RFPL4A (NM_001145014) Human Mass Spec Standard

Be the first to review this product
SKU
PH327429
RFPL4A MS Standard C13 and N15-labeled recombinant protein (NP_001138486)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316363 Rabbit polyclonal anti-RFPL4A antibody
100 ul
$380.00
LY428643 Transient overexpression lysate of ret finger protein-like 4A (RFPL4A) (as WB positive control) 100 ug
$436.00

Other products for "RFPL4A or NM_001145014"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227429
Predicted MW 32.1 kDa
Protein Sequence
Protein Sequence
>RC227429 representing NM_001145014
Red=Cloning site Green=Tags(s)

MAEHFKQIIRCPVCLKDLEEAVQLKCGYACCLQCLNSLQKEPDGEGLLCRFCSVVSQKDDIKPKYKLRAL
VSIIKELEPKLKSVLTMNPRMRKFQVDMTFDVDTANNYLIISEDLRSFRSGDLSQNRKEQAERFDTALCV
LGTPRFTSGRHYWEVDVGTSQVWDVGVCKESVNRQGKIVLSSEHGFLTVGCREGKVFAASTVPMTPLWVS
PQLHRVGIFLDVGMRSIAFYNVSDGCHIYTFIEIPVCEPWRPFFAHKRGSQDDQSILSICSVINPSAASA
PVSSEGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138486
RefSeq ORF 861
Synonyms RFPL4; RNF210
Locus ID 342931
UniProt ID A6NLU0
Cytogenetics 19q13.42
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RFPL4A" proteins (3)
SKU Description Size Price
LC428643 Lyophilized RFPL4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY428643 Transient overexpression lysate of ret finger protein-like 4A (RFPL4A) (as WB positive control) 100 ug
$436.00
TP327429 Recombinant protein of human ret finger protein-like 4A (RFPL4A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products