OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EFCAB2 (NM_001143943) Human Mass Spec Standard

Be the first to review this product
SKU
PH326751
EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137415)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410204 Transient overexpression lysate of EF-hand calcium binding domain 2 (EFCAB2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "EFCAB2 or NM_001143943"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226751
Predicted MW 15.3 kDa
Protein Sequence
Protein Sequence
>RC226751 representing NM_001143943
Red=Cloning site Green=Tags(s)

MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGY
IRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEDGVSLRRPG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001137415
RefSeq ORF 399
Synonyms CFAP200; DRC8
Locus ID 84288
UniProt ID Q5VUJ9
Cytogenetics 1q44
Summary The gene encodes a protein that contains two EF-hand calcium-binding domains although its function has yet to be determined. Alternatively spliced transcripts have been observed. provided by RefSeq, Mar 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EFCAB2" proteins (7)
SKU Description Size Price
PH302779 EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_115704) 10 ug
$3,360.00
LC410204 Lyophilized EFCAB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428415 Lyophilized EFCAB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410204 Transient overexpression lysate of EF-hand calcium binding domain 2 (EFCAB2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428415 Transient overexpression lysate of EF-hand calcium binding domain 2 (EFCAB2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302779 Recombinant protein of human EF-hand calcium binding domain 2 (EFCAB2), transcript variant 1, 20 µg 20 ug
$867.00
TP326751 Purified recombinant protein of Homo sapiens EF-hand calcium binding domain 2 (EFCAB2), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products