OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ABH2 (ALKBH2) (NM_001145374) Human Mass Spec Standard

Be the first to review this product
SKU
PH326507
ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320088 Rabbit Polyclonal ALKBH2 Antibody
100 ug
$640.00
LY400362 Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "ABH2 or NM_001145374"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC226507
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC226507 protein sequence
Red=Cloning site Green=Tags(s)

MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT
VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER
IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR
VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138846
RefSeq Size 1206
RefSeq ORF 783
Synonyms ABH2
Locus ID 121642
UniProt ID Q6NS38
Cytogenetics 12q24.11
Summary The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 PubMed 12486230).supplied by OMIM, Mar 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ABH2" proteins (11)
SKU Description Size Price
PH310103 ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655) 10 ug
$3,360.00
PH326527 ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847) 10 ug
$3,360.00
LC400362 Lyophilized ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428853 Lyophilized ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428854 Lyophilized ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400362 Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428853 Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428854 Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP310103 Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2, 20 µg 20 ug
$867.00
TP326507 Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1, 20 µg 20 ug
$867.00
TP326527 Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products