ABH2 (ALKBH2) (NM_001145375) Human Mass Spec Standard

SKU
PH326527
ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138847)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226527]
Predicted MW 29.3 kDa
Protein Sequence
Protein Sequence
>RC226527 protein sequence
Red=Cloning site Green=Tags(s)

MDRFLVKGAQGGLLRKQEEQEPTGEEPAVLGGDKESTRKRPRREAPGNGGHSAGPSWRHIRAEGLDCSYT
VLFGKAEADEIFQELEKEVEYFTGALARVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLSPKPWIPVLER
IRDHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRR
VAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRKILLTKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138847
RefSeq Size 953
RefSeq ORF 783
Synonyms ABH2
Locus ID 121642
UniProt ID Q6NS38
Cytogenetics 12q24.11
Summary The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 (MIM 610603) are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine (Duncan et al., 2002 [PubMed 12486230]).[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ABH2 (ALKBH2) (NM_001145375) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310103 ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001001655) 10 ug
$3,255.00
PH326507 ALKBH2 MS Standard C13 and N15-labeled recombinant protein (NP_001138846) 10 ug
$3,255.00
LC400362 ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428853 ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428854 ALKBH2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400362 Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2 100 ug
$436.00
LY428853 Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1 100 ug
$436.00
LY428854 Transient overexpression lysate of alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3 100 ug
$436.00
TP310103 Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326507 Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326527 Recombinant protein of human alkB, alkylation repair homolog 2 (E. coli) (ALKBH2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.