OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASPA (NM_001128085) Human Mass Spec Standard

Be the first to review this product
SKU
PH325443
ASPA MS Standard C13 and N15-labeled recombinant protein (NP_001121557)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA805304 ASPA mouse monoclonal antibody, clone OTI3G5 (formerly 3G5) 100 ul
$447.00
LY424954 Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ASPA or NM_001128085"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225443
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC225443 protein sequence
Red=Cloning site Green=Tags(s)

MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN
RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF
HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN
EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP
VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121557
RefSeq Size 1368
RefSeq ORF 939
Synonyms ACY2; ASP
Locus ID 443
UniProt ID P45381
Cytogenetics 17p13.2
Summary This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Alanine, aspartate and glutamate metabolism, Histidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ASPA" proteins (7)
SKU Description Size Price
PH306564 ASPA MS Standard C13 and N15-labeled recombinant protein (NP_000040) 10 ug
$3,360.00
LC424954 Lyophilized ASPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426889 Lyophilized ASPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY424954 Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426889 Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306564 Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 1, 20 µg 20 ug
$737.00
TP325443 Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products