ASPA (NM_000049) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206564] |
Predicted MW | 35.7 kDa |
Protein Sequence |
Protein Sequence
>RC206564 protein sequence
Red=Cloning site Green=Tags(s) MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000040 |
RefSeq Size | 1435 |
RefSeq ORF | 939 |
Synonyms | ACY2; ASP |
Locus ID | 443 |
UniProt ID | P45381 |
Cytogenetics | 17p13.2 |
Summary | This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Histidine metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH325443 | ASPA MS Standard C13 and N15-labeled recombinant protein (NP_001121557) | 10 ug |
$3,255.00
|
|
LC424954 | ASPA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426889 | ASPA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY424954 | Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 1 | 100 ug |
$436.00
|
|
LY426889 | Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 2 | 100 ug |
$436.00
|
|
TP306564 | Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP325443 | Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.