ASPA (NM_001128085) Human Mass Spec Standard

SKU
PH325443
ASPA MS Standard C13 and N15-labeled recombinant protein (NP_001121557)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225443]
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC225443 protein sequence
Red=Cloning site Green=Tags(s)

MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLN
RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMF
HYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFN
EGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYP
VFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121557
RefSeq Size 1368
RefSeq ORF 939
Synonyms ACY2; ASP
Locus ID 443
UniProt ID P45381
Cytogenetics 17p13.2
Summary This gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Alanine, aspartate and glutamate metabolism, Histidine metabolism
Write Your Own Review
You're reviewing:ASPA (NM_001128085) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306564 ASPA MS Standard C13 and N15-labeled recombinant protein (NP_000040) 10 ug
$3,255.00
LC424954 ASPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426889 ASPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424954 Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 1 100 ug
$436.00
LY426889 Transient overexpression lysate of aspartoacylase (Canavan disease) (ASPA), transcript variant 2 100 ug
$436.00
TP306564 Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 1, 20 µg 20 ug
$737.00
TP325443 Recombinant protein of human aspartoacylase (Canavan disease) (ASPA), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.