OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HCCS (NM_001122608) Human Mass Spec Standard

Be the first to review this product
SKU
PH325362
HCCS MS Standard C13 and N15-labeled recombinant protein (NP_001116080)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY426535 Transient overexpression lysate of holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "HCCS or NM_001122608"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225362
Predicted MW 30.4 kDa
Protein Sequence
Protein Sequence
>RC225362 representing NM_001122608
Red=Cloning site Green=Tags(s)

MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRG
TAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDE
DISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDR
HDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001116080
RefSeq ORF 804
Synonyms CCHL; LSDMCA1; MCOPS7; MLS
Locus ID 3052
UniProt ID P53701
Cytogenetics Xp22.2
Summary The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. provided by RefSeq, Jan 2010
Protein Pathways Porphyrin and chlorophyll metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HCCS" proteins (3)
SKU Description Size Price
LC426535 Lyophilized HCCS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY426535 Transient overexpression lysate of holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP325362 Recombinant protein of human holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products