HCCS (NM_001122608) Human Recombinant Protein

SKU
TP325362
Recombinant protein of human holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225362 representing NM_001122608
Red=Cloning site Green=Tags(s)

MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRG
TAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDE
DISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDR
HDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001116080
Locus ID 3052
UniProt ID P53701
Cytogenetics Xp22.2
RefSeq ORF 804
Synonyms CCHL; LSDMCA1; MCOPS7; MLS
Summary The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010]
Protein Pathways Porphyrin and chlorophyll metabolism
Write Your Own Review
You're reviewing:HCCS (NM_001122608) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH325362 HCCS MS Standard C13 and N15-labeled recombinant protein (NP_001116080) 10 ug
$3,255.00
LC426535 HCCS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY426535 Transient overexpression lysate of holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.