OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CNBP (NM_001127196) Human Mass Spec Standard

Be the first to review this product
SKU
PH325167
CNBP MS Standard C13 and N15-labeled recombinant protein (NP_001120668)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418710 Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "CNBP or NM_001127196"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225167
Predicted MW 18.6 kDa
Protein Sequence
Protein Sequence
>RC225167 representing NM_001127196
Red=Cloning site Green=Tags(s)

MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNC
GRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVA
INCSKTSEVNCYRCGESGHLARECTIEATA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001120668
RefSeq ORF 510
Synonyms CNBP1; DM2; PROMM; RNF163; ZCCHC22; ZNF9
Locus ID 7555
UniProt ID P62633
Cytogenetics 3q21.3
Summary This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion from <30 repeats to 75-11000 repeats in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2016
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CNBP" proteins (9)
SKU Description Size Price
PH314473 CNBP MS Standard C13 and N15-labeled recombinant protein (NP_003409) 10 ug
$3,360.00
LC418710 Lyophilized CNBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426696 Lyophilized CNBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426700 Lyophilized CNBP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418710 Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY426696 Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426700 Transient overexpression lysate of CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP314473 Recombinant protein of human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 20 µg 20 ug
$737.00
TP325167 Purified recombinant protein of Homo sapiens CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 6, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products