CNBP (NM_003418) Human Recombinant Protein

SKU TP314473

Recombinant protein of human CCHC-type zinc finger, nucleic acid binding protein (CNBP), transcript variant 3, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214473 representing NM_003418; Red=Cloning site Green=Tags(s); ; MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQ; EDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRC; GETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003409
• Locus ID: 7555
• UniProt ID: P62633
• Cytogenetics: 3q21.3
• RefSeq Size: 1500
• RefSeq ORF: 531
• Synonyms: CNBP1; DM2; PROMM; RNF163; ZCCHC22; ZNF9
• Summary: This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion from <30 repeats to 75-11000 repeats in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome, Transcription Factors