OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

YPEL5 (NM_001127401) Human Mass Spec Standard

Be the first to review this product
SKU
PH325061
YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120873)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367782 YPEL5 rabbit polyclonal antibody
100 ul
$310.00
LY402494 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 4 (as WB positive control) 100 ug
$436.00

Other products for "YPEL5 or NM_001127401"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225061
Predicted MW 13.8 kDa
Protein Sequence
Protein Sequence
>RC225061 protein sequence
Red=Cloning site Green=Tags(s)

MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRD
VSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001120873
RefSeq Size 2639
RefSeq ORF 363
Synonyms CGI-127
Locus ID 51646
UniProt ID P62699
Cytogenetics 2p23.1
Summary Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Required for normal cell proliferation (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "YPEL5" proteins (15)
SKU Description Size Price
PH301463 YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_057145) 10 ug
$3,360.00
PH325059 YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120871) 10 ug
$3,360.00
PH325060 YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120872) 10 ug
$3,360.00
LC402494 Lyophilized YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426781 Lyophilized YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426782 Lyophilized YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426783 Lyophilized YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402494 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY426781 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY426782 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426783 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301463 Recombinant protein of human yippee-like 5 (Drosophila) (YPEL5), transcript variant 4, 20 µg 20 ug
$867.00
TP325059 Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 3, 20 µg 20 ug
$867.00
TP325060 Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 2, 20 µg 20 ug
$867.00
TP325061 Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products