YPEL5 (NM_001127401) Human Recombinant Protein
SKU
TP325061
Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 1, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC225061 protein sequence
Red=Cloning site Green=Tags(s) MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRD VSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001120873 |
Locus ID | 51646 |
UniProt ID | P62699 |
Cytogenetics | 2p23.1 |
RefSeq Size | 2639 |
RefSeq ORF | 363 |
Synonyms | CGI-127 |
Summary | Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Required for normal cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301463 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_057145) | 10 ug |
$3,255.00
|
|
PH325059 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120871) | 10 ug |
$3,255.00
|
|
PH325060 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120872) | 10 ug |
$3,255.00
|
|
PH325061 | YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120873) | 10 ug |
$3,255.00
|
|
LC402494 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426781 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426782 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426783 | YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402494 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 4 | 100 ug |
$436.00
|
|
LY426781 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 3 | 100 ug |
$436.00
|
|
LY426782 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 2 | 100 ug |
$436.00
|
|
LY426783 | Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 1 | 100 ug |
$436.00
|
|
TP301463 | Recombinant protein of human yippee-like 5 (Drosophila) (YPEL5), transcript variant 4, 20 µg | 20 ug |
$867.00
|
|
TP325059 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP325060 | Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.