YPEL5 (NM_001127401) Human Mass Spec Standard

SKU
PH325061
YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120873)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225061]
Predicted MW 13.8 kDa
Protein Sequence
Protein Sequence
>RC225061 protein sequence
Red=Cloning site Green=Tags(s)

MGRIFLDHIGGTRLFSCANCDTILTNRSELISTRFTGATGRAFLFNKVVNLQYSEVQDRVMLTGRHMVRD
VSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001120873
RefSeq Size 2639
RefSeq ORF 363
Synonyms CGI-127
Locus ID 51646
UniProt ID P62699
Cytogenetics 2p23.1
Summary Component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1 (PubMed:29911972). Required for normal cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:YPEL5 (NM_001127401) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301463 YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_057145) 10 ug
$3,255.00
PH325059 YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120871) 10 ug
$3,255.00
PH325060 YPEL5 MS Standard C13 and N15-labeled recombinant protein (NP_001120872) 10 ug
$3,255.00
LC402494 YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426781 YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426782 YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426783 YPEL5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402494 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 4 100 ug
$436.00
LY426781 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 3 100 ug
$436.00
LY426782 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 2 100 ug
$436.00
LY426783 Transient overexpression lysate of yippee-like 5 (Drosophila) (YPEL5), transcript variant 1 100 ug
$436.00
TP301463 Recombinant protein of human yippee-like 5 (Drosophila) (YPEL5), transcript variant 4, 20 µg 20 ug
$867.00
TP325059 Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 3, 20 µg 20 ug
$867.00
TP325060 Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 2, 20 µg 20 ug
$867.00
TP325061 Purified recombinant protein of Homo sapiens yippee-like 5 (Drosophila) (YPEL5), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.