OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPINT3 (NM_006652) Human Mass Spec Standard

Be the first to review this product
SKU
PH325005
SPINT3 MS Standard C13 and N15-labeled recombinant protein (NP_006643)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY429308 Transient overexpression lysate of serine peptidase inhibitor, Kunitz type, 3 (SPINT3) (as WB positive control) 100 ug
$436.00

Other products for "SPINT3 or NM_006652"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC225005
Predicted MW 10.1 kDa
Protein Sequence
Protein Sequence
>RC225005 representing NM_006652
Red=Cloning site Green=Tags(s)

MQLQASLSFLLILTLCLELRSELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCG
GNSNNFLRKEKCEKFCKFT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006643
RefSeq ORF 267
Synonyms HKIB9
Locus ID 10816
UniProt ID P49223
Cytogenetics 20q13.12
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPINT3" proteins (3)
SKU Description Size Price
LC429308 Lyophilized SPINT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY429308 Transient overexpression lysate of serine peptidase inhibitor, Kunitz type, 3 (SPINT3) (as WB positive control) 100 ug
$436.00
TP325005 Recombinant protein of human serine peptidase inhibitor, Kunitz type, 3 (SPINT3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products