OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

POLR2J2 (NM_032959) Human Mass Spec Standard

Be the first to review this product
SKU
PH324755
POLR2J2 MS Standard C13 and N15-labeled recombinant protein (NP_116581)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502454 POLR2J2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4) 100 ul
$447.00
LY409843 Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) (as WB positive control) 100 ug
$436.00

Other products for "POLR2J2 or NM_032959"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224755
Predicted MW 12.9 kDa
Protein Sequence
Protein Sequence
>RC224755 representing NM_032959
Red=Cloning site Green=Tags(s)

MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI
IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116581
RefSeq Size 1727
RefSeq ORF 345
Synonyms HRPB11B; POLR2J3; RPB11b1; RPB11b2
Locus ID 246721
UniProt ID Q9GZM3
Cytogenetics 7q22.1
Summary This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "POLR2J2" proteins (4)
SKU Description Size Price
LC409843 Lyophilized POLR2J2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409843 Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) (as WB positive control) 100 ug
$436.00
TP324755 Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), 20 µg 20 ug
$867.00
TP760696 Purified recombinant protein of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products