POLR2J2 (NM_032959) Human Tagged ORF Clone

SKU
RC224755
POLR2J2 (Myc-DDK-tagged)-Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol POLR2J2
Synonyms HRPB11B; POLR2J3; RPB11b1; RPB11b2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC224755 representing NM_032959
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGCCCCTCCAGCCTTCGAGTCGTTCTTGCTCTTCGAGGGCGAGAAGATCACCATTAACAAGGACA
CCAAGGTACCCAATGCCTGTTTATTCACCATGAACAAAGAAGACCACACACTGGGAAACATCATTAAATC
ACAACTCCTAAAAGACCCGCAAGTGCTATTTGCTGGCTACAAAGTCCCCCACCCCTTGGAGCACAAGATC
ATCATCCGAGTGCAGACCACGCCGGACTACAGCCCCCAGGAAGCCTTTACCAACGCCATCACCGACCTCA
TCAGCGAGCTGTCCCTGCTGGAGGAGCGCTTCCGGACGTGCCTGCTTCCCCTTCGCCTTCTGCCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC224755 representing NM_032959
Red=Cloning site Green=Tags(s)

MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI
IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032959
ORF Size 345 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032959.1
RefSeq Size 1727 bp
RefSeq ORF 348 bp
Locus ID 246721
UniProt ID Q9GZM3
Cytogenetics 7q22.1
Domains RNA_pol_L
Protein Families Transcription Factors
Protein Pathways Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
MW 12.9 kDa
Summary This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:POLR2J2 (NM_032959) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224755L3 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), Myc-DDK-tagged 10 ug
$450.00
RC224755L4 Lenti ORF clone of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), mGFP tagged 10 ug
$450.00
RG224755 POLR2J2 (tGFP-tagged) - Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) 10 ug
$489.00
SC110811 POLR2J2 (untagged)-Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.