OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CSEN (KCNIP3) (NM_001034914) Human Mass Spec Standard

Be the first to review this product
SKU
PH324492
KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001030086)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA804386 KCNIP3 mouse monoclonal antibody,clone OTI3A12 100 ul
$447.00
LY415545 Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CSEN or NM_001034914"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224492
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC224492 representing NM_001034914
Red=Cloning site Green=Tags(s)

MGIQGMELCAMAVVVLLFIAVLKQFGILEPISMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSL
YRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEK
LKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFL
EACQKDENIMSSMQLFENVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001030086
RefSeq Size 2735
RefSeq ORF 690
Synonyms CSEN; DREAM; KCHIP3
Locus ID 30818
UniProt ID Q9Y2W7
Cytogenetics 2q11.1
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CSEN" proteins (7)
SKU Description Size Price
PH303957 KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_038462) 10 ug
$3,360.00
LC415545 Lyophilized KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422112 Lyophilized KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415545 Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422112 Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303957 Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, 20 µg 20 ug
$737.00
TP324492 Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products