CSEN (KCNIP3) (NM_013434) Human Mass Spec Standard

SKU PH303957

KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_038462)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203957]
• Predicted MW: 29.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC203957 protein sequence; Red=Cloning site Green=Tags(s); ; MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELS; TVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDA; DGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDA; PAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_038462
• RefSeq Size: 2928
• RefSeq ORF: 768
• Synonyms: CSEN; DREAM; KCHIP3
• Locus ID: 30818
• UniProt ID: Q9Y2W7
• Cytogenetics: 2q11.1
• Summary: This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors, Transmembrane