CSEN (KCNIP3) (NM_001034914) Human Mass Spec Standard

SKU
PH324492
KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_001030086)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224492]
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC224492 representing NM_001034914
Red=Cloning site Green=Tags(s)

MGIQGMELCAMAVVVLLFIAVLKQFGILEPISMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSL
YRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEK
LKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFL
EACQKDENIMSSMQLFENVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001030086
RefSeq Size 2735
RefSeq ORF 690
Synonyms CSEN; DREAM; KCHIP3
Locus ID 30818
UniProt ID Q9Y2W7
Cytogenetics 2q11.1
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors, Transmembrane
Write Your Own Review
You're reviewing:CSEN (KCNIP3) (NM_001034914) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303957 KCNIP3 MS Standard C13 and N15-labeled recombinant protein (NP_038462) 10 ug
$3,255.00
LC415545 KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422112 KCNIP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415545 Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 100 ug
$436.00
LY422112 Transient overexpression lysate of Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2 100 ug
$436.00
TP303957 Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, 20 µg 20 ug
$737.00
TP324492 Recombinant protein of human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.