CSEN (KCNIP3) (NM_013434) Human Tagged ORF Clone

SKU
RC203957
KCNIP3 (Myc-DDK-tagged)-Human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CSEN
Synonyms CSEN; DREAM; KCHIP3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203957 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCGGCTAAGGAAGTGACAAAGGCGTCGGACGGCAGCCTCCTGGGGGACCTCGGGCACACACCAC
TTAGCAAGAAGGAGGGTATCAAGTGGCAGAGGCCGAGGCTCAGCCGCCAGGCTTTGATGAGATGCTGCCT
GGTCAAGTGGATCCTGTCCAGCACAGCCCCACAGGGCTCAGATAGCAGCGACAGTGAGCTGGAGCTGTCC
ACGGTGCGCCACCAGCCAGAGGGGCTGGACCAGCTGCAGGCCCAGACCAAGTTCACCAAGAAGGAGCTGC
AGTCTCTCTACAGGGGCTTTAAGAATGAGTGTCCCACGGGCCTGGTGGACGAAGACACCTTCAAACTCAT
TTACGCGCAGTTCTTCCCTCAGGGAGATGCCACCACCTATGCACACTTCCTCTTCAACGCCTTTGATGCG
GACGGGAACGGGGCCATCCACTTTGAGGACTTTGTGGTTGGCCTCTCCATCCTGCTGCGGGGCACAGTCC
ACGAGAAGCTCAAGTGGGCCTTTAATCTCTACGACATTAACAAGGATGGCTACATCACCAAAGAGGAGAT
GCTGGCCATCATGAAGTCCATCTATGACATGATGGGCCGCCACACCTACCCCATCCTGCGGGAGGACGCG
CCGGCGGAGCACGTGGAGAGGTTCTTCGAGAAAATGGACCGGAACCAGGATGGGGTAGTGACCATTGAAG
AGTTCCTGGAGGCCTGTCAGAAGGATGAGAACATCATGAGCTCCATGCAGCTGTTTGAGAATGTCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203957 protein sequence
Red=Cloning site Green=Tags(s)

MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGSDSSDSELELS
TVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDA
DGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPILREDA
PAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013434
ORF Size 768 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013434.5
RefSeq Size 2928 bp
RefSeq ORF 771 bp
Locus ID 30818
UniProt ID Q9Y2W7
Cytogenetics 2q11.1
Protein Families Druggable Genome, Transcription Factors, Transmembrane
MW 29.2 kDa
Summary This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domains. They are integral subunit components of native Kv4 channel complexes that may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. The encoded protein also functions as a calcium-regulated transcriptional repressor, and interacts with presenilins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CSEN (KCNIP3) (NM_013434) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203957L1 Lenti ORF clone of Human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203957L2 Lenti ORF clone of Human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, mGFP tagged 10 ug
$600.00
RC203957L3 Lenti ORF clone of Human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC203957L4 Lenti ORF clone of Human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1, mGFP tagged 10 ug
$600.00
RG203957 KCNIP3 (tGFP-tagged) - Human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC122794 KCNIP3 (untagged)-Human Kv channel interacting protein 3, calsenilin (KCNIP3), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.