BEND6 (NM_152731) Human Mass Spec Standard

SKU
PH324260
BEND6 MS Standard C13 and N15-labeled recombinant protein (NP_689944)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224260]
Predicted MW 31 kDa
Protein Sequence
Protein Sequence
>RC224260 representing NM_152731
Red=Cloning site Green=Tags(s)

MQKIVQTDEITNTQAFRKGKRKRTETMDSENANSDMDKGQRDPYSGNAFLPGESSSEDEEPLAELSKEEL
CAKIKSLKEKLTNTRKENSRLRQSLVMLQVLPQAVTQFEELVGMAEALLKGGGTMSTSASTLWRATNNSS
PDSFASTCSNSNSNSSSPVSLKPEEEHQTDEKQFQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHS
LTGAKSSTSRDKAVKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTKKPNLSKNLNSQDIK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689944
RefSeq Size 2727
RefSeq ORF 837
Synonyms C6orf65
Locus ID 221336
UniProt ID Q5SZJ8
Cytogenetics 6p12.1
Summary Acts as a corepressor of recombining binding protein suppressor hairless (RBPJ) and inhibits Notch signaling in neural stem cells, thereby opposing their self-renewal and promoting neurogenesis (PubMed:23571214).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:BEND6 (NM_152731) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407329 BEND6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407329 Transient overexpression lysate of BEN domain containing 6 (BEND6) 100 ug
$436.00
TP324260 Recombinant protein of human BEN domain containing 6 (BEND6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.