OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTAR1 (NM_001099666) Human Mass Spec Standard

Be the first to review this product
SKU
PH324206
PTAR1 MS Standard C13 and N15-labeled recombinant protein (NP_001093136)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332209 Rabbit Polyclonal Anti-PTAR1 Antibody
100 ul
$585.00
LY420480 Transient overexpression lysate of protein prenyltransferase alpha subunit repeat containing 1 (PTAR1) (as WB positive control) 100 ug
$436.00

Other products for "PTAR1 or NM_001099666"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224206
Predicted MW 46.2 kDa
Protein Sequence
Protein Sequence
>RC224206 representing NM_001099666
Red=Cloning site Green=Tags(s)

MAETSEEVAVLVQRVVKDITNAFRRNPHIDEIGLIPCPEARYNRSPIVLVENKLGVESWCVKFLLPYVHN
KLLLYRTRKQWLNRDELIDVTCTLLLLNPDFTTAWNVRKELILSGTLNPIKDLHLGKLALTKFPKSPETW
IHRRWVLQQLIQETSLPSFVTKGNLGTIPTERAQRLIQEEMEVCGEAAGRYPSNYNAWSHRIWVLQHLAK
LDVKILLDELSSTKHWASMHVSDHSGFHYRQFLLKSLISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVS
TEEPRINLPHLLEEEVEFSTDLIDSYPGHETLWCHRRHIFYLQHHLNAGSQLSQAMEVDGLNDSSKQGYS
QETKRLKRTPVPDSLGLEMEHRFIDQVLSTCRNVEQARFASAYRKWLVTLSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001093136
RefSeq Size 10057
RefSeq ORF 1206
Locus ID 375743
UniProt ID Q7Z6K3
Cytogenetics 9q21.12
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTAR1" proteins (3)
SKU Description Size Price
LC420480 Lyophilized PTAR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420480 Transient overexpression lysate of protein prenyltransferase alpha subunit repeat containing 1 (PTAR1) (as WB positive control) 100 ug
$436.00
TP324206 Recombinant protein of human protein prenyltransferase alpha subunit repeat containing 1 (PTAR1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products