OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C19orf54 (NM_198476) Human Mass Spec Standard

Be the first to review this product
SKU
PH324199
C19orf54 MS Standard C13 and N15-labeled recombinant protein (NP_940878)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA333369 Rabbit Polyclonal Anti-C19orf54 Antibody
100 ul
$585.00
LY404910 Transient overexpression lysate of chromosome 19 open reading frame 54 (C19orf54) (as WB positive control) 100 ug
$436.00

Other products for "C19orf54 or NM_198476"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224199
Predicted MW 37.6 kDa
Protein Sequence
Protein Sequence
>RC224199 representing NM_198476
Red=Cloning site Green=Tags(s)

MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQTPVPPPLPLPPPPAATGPAPR
HVFGLEKSQLLKEAFDKAGPVPKGREDVKRLLKLHKDRFRGDLRWILFCADLPSLIQEGPQCGLVALWMA
GTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVLQHLVTG
HPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLPEEG
SPGAVYLLSKQGKSWHYQLWDYDQVRESNLQLTDFSPSRATDGRVYVVPVGGVRAGLCGQALLLTPQDCS
H

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940878
RefSeq Size 2769
RefSeq ORF 1053
Locus ID 284325
UniProt ID Q5BKX5
Cytogenetics 19q13.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "C19orf54" proteins (3)
SKU Description Size Price
LC404910 Lyophilized C19orf54 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404910 Transient overexpression lysate of chromosome 19 open reading frame 54 (C19orf54) (as WB positive control) 100 ug
$436.00
TP324199 Recombinant protein of human chromosome 19 open reading frame 54 (C19orf54), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products