OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD252 (TNFSF4) (NM_003326) Human Mass Spec Standard

Be the first to review this product
SKU
PH324021
TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA806677 TNFSF4 mouse monoclonal antibody,clone OTI5D8 100 ul
$447.00
LY401143 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4) (as WB positive control) 100 ug
$436.00

Other products for "CD252 or NM_003326"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC224021
Predicted MW 20.9 kDa
Protein Sequence
Protein Sequence
>RC224021 representing NM_003326
Red=Cloning site Green=Tags(s)

MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK
KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV
ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003317
RefSeq Size 3510
RefSeq ORF 549
Synonyms CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1
Locus ID 7292
UniProt ID P23510
Cytogenetics 1q25.1
Summary This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2014
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD252" proteins (5)
SKU Description Size Price
LC401143 Lyophilized TNFSF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401143 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4) (as WB positive control) 100 ug
$436.00
TP324021 Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4), 20 µg 20 ug
$737.00
TP700285 Purified recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4), with C-terminal Fc tag, expressed in human cells, 20 µg 20 ug
$900.00
TP723944 Recombinant human OX40L protein with N-terminal mouse Fc and C-terminal 6×His tag 100 ug
$905.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products