OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIPRL (NM_152902) Human Mass Spec Standard

Be the first to review this product
SKU
PH323912
TIPRL MS Standard C13 and N15-labeled recombinant protein (NP_690866)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500853 Anti-TIPRL mouse monoclonal antibody, clone OTI3D11 (formerly 3D11) 100 ul
$447.00
LY403496 Transient overexpression lysate of TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TIPRL or NM_152902"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223912
Predicted MW 31.3 kDa
Protein Sequence
Protein Sequence
>RC223912 representing NM_152902
Red=Cloning site Green=Tags(s)

MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT
DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK
LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM
LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_690866
RefSeq Size 3032
RefSeq ORF 816
Synonyms TIP; TIP41; TIPRL1
Locus ID 261726
UniProt ID O75663
Cytogenetics 1q24.2
Summary TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A) (see PPP2CA; MIM 176915), PP4 (see PPP4C; MIM 602035), and PP6 (see PPP6C; MIM 612725) (McConnell et al., 2007 PubMed 17384681).supplied by OMIM, Nov 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TIPRL" proteins (5)
SKU Description Size Price
LC403496 Lyophilized TIPRL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422192 Lyophilized TIPRL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403496 Transient overexpression lysate of TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422192 Transient overexpression lysate of TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP323912 Recombinant protein of human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products