TIPRL (NM_152902) Human Tagged ORF Clone

SKU
RC223912
TIPRL (Myc-DDK-tagged)-Human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TIPRL
Synonyms TIP; TIP41; TIPRL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223912 representing NM_152902
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGATCCACGGCTTCCAGAGCAGCCACCGGGATTTCTGCTTCGGGCCCTGGAAGCTGACGGCGTCCA
AGACCCACATCATGAAGTCGGCGGATGTGGAGAAATTAGCCGATGAATTACATATGCCATCTCTCCCTGA
AATGATGTTTGGAGACAACGTTTTAAGAATCCAGCATGGGTCTGGCTTTGGAATTGAGTTCAATGCTACA
GATGCGTTAAGATGTGTAAACAACTACCAAGGAATGCTTAAAGTGGCCTGTGCTGAAGAGTGGCAAGAAA
GCAGGACGGAGGGTGAACACTCCAAAGAGGTTATTAAACCATATGATTGGACCTATACAACAGATTATAA
GGGAACCTTACTTGGAGAATCTCTTAAGTTAAAGGTTGTACCTACAACAGATCATATAGATACAGAAAAA
TTGAAAGCCAGAGAACAGATTAAGTTTTTTGAAGAAGTTCTCCTTTTTGAGGATGAACTTCATGATCATG
GAGTTTCAAGCCTGAGTGTGAAGATTAGAGTAATGCCTTCTAGCTTTTTCCTGCTGTTGCGGTTTTTCTT
GAGAATTGATGGGGTGCTTATCAGAATGAATGACACGAGACTTTACCATGAGGCTGACAAGACCTACATG
TTACGAGAATATACGTCACGAGAAAGCAAAATTTCTAGTTTGATGCATGTTCCACCTTCCCTCTTCACGG
AACCTAATGAAATATCCCAGTATTTACCAATAAAGGAAGCAGTTTGTGAGAAGCTAATATTTCCAGAAAG
AATTGATCCTAACCCAGCAGACTCACAAAAAAGTACACAAGTGGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC223912 representing NM_152902
Red=Cloning site Green=Tags(s)

MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNAT
DALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEK
LKAREQIKFFEEVLLFEDELHDHGVSSLSVKIRVMPSSFFLLLRFFLRIDGVLIRMNDTRLYHEADKTYM
LREYTSRESKISSLMHVPPSLFTEPNEISQYLPIKEAVCEKLIFPERIDPNPADSQKSTQVE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152902
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152902.5
RefSeq Size 3032 bp
RefSeq ORF 819 bp
Locus ID 261726
UniProt ID O75663
Cytogenetics 1q24.2
Domains TIP41
MW 31.3 kDa
Summary TIPRL is an inhibitory regulator of protein phosphatase-2A (PP2A) (see PPP2CA; MIM 176915), PP4 (see PPP4C; MIM 602035), and PP6 (see PPP6C; MIM 612725) (McConnell et al., 2007 [PubMed 17384681]).[supplied by OMIM, Nov 2010]
Write Your Own Review
You're reviewing:TIPRL (NM_152902) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223912L1 Lenti ORF clone of Human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC223912L2 Lenti ORF clone of Human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1, mGFP tagged 10 ug
$600.00
RC223912L3 Lenti ORF clone of Human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC223912L4 Lenti ORF clone of Human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1, mGFP tagged 10 ug
$600.00
RG223912 TIPRL (tGFP-tagged) - Human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC100639 TIPRL (untagged)-Human TIP41, TOR signaling pathway regulator-like (S. cerevisiae) (TIPRL), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.