OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TNNT3 (NM_001042782) Human Mass Spec Standard

Be the first to review this product
SKU
PH323893
TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036247)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339175 Rabbit Polyclonal Anti-TNNT3
100 ul
$585.00
LY425799 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "TNNT3 or NM_001042782"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223893
Predicted MW 29.7 kDa
Protein Sequence
Protein Sequence
>RC223893 protein sequence
Red=Cloning site Green=Tags(s)

MSDEEVEQVEEQYEEEEEAQEEEEVQEEEKPRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSH
FEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALS
SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFG
EKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001036247
RefSeq Size 1193
RefSeq ORF 750
Synonyms beta-TnTF; DA2B2; TNTF
Locus ID 7140
UniProt ID P45378
Cytogenetics 11p15.5
Summary The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B). provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TNNT3" proteins (13)
SKU Description Size Price
PH312563 TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036245) 10 ug
$3,360.00
PH316642 TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_006748) 10 ug
$3,360.00
LC402019 Lyophilized TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420809 Lyophilized TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420811 Lyophilized TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425799 Lyophilized TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402019 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420809 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY420811 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY425799 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP312563 Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3, 20 µg 20 ug
$867.00
TP316642 Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1, 20 µg 20 ug
$737.00
TP323893 Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products