TNNT3 (NM_001042780) Human Mass Spec Standard

SKU
PH312563
TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036245)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212563]
Predicted MW 30.2 kDa
Protein Sequence
Protein Sequence
>RC212563 representing NM_001042780
Red=Cloning site Green=Tags(s)

MSDEEVEQVEEQYEEEEEAQEEEEVQEEEKPRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSH
FEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAEDDLKKKKALS
SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFG
EKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001036245
RefSeq Size 1193
RefSeq ORF 750
Synonyms beta-TnTF; DA2B2; TNTF
Locus ID 7140
UniProt ID P45378
Cytogenetics 11p15.5
Summary The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments. The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction. The troponin complex has protein subunits C, I, and T. Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction. Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity. There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle. This gene encodes fast skeletal troponin T protein; also known as troponin T type 3. Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms. A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs. Additional splice variants have been described but their biological validity has not been established. Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B). [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:TNNT3 (NM_001042780) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316642 TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_006748) 10 ug
$3,255.00
PH323893 TNNT3 MS Standard C13 and N15-labeled recombinant protein (NP_001036247) 10 ug
$3,255.00
LC402019 TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420809 TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420811 TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425799 TNNT3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402019 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1 100 ug
$436.00
LY420809 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 100 ug
$436.00
LY420811 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4 100 ug
$436.00
LY425799 Transient overexpression lysate of troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3 100 ug
$436.00
TP312563 Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP316642 Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 1, 20 µg 20 ug
$737.00
TP323893 Recombinant protein of human troponin T type 3 (skeletal, fast) (TNNT3), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.