OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CFHR5 (NM_030787) Human Mass Spec Standard

Be the first to review this product
SKU
PH323868
CFHR5 MS Standard C13 and N15-labeled recombinant protein (NP_110414)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA337960 Rabbit Polyclonal Anti-CFHR5 Antibody
100 ul
$585.00
LY410709 Transient overexpression lysate of complement factor H-related 5 (CFHR5) (as WB positive control) 100 ug
$665.00

Other products for "CFHR5 or NM_030787"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223868
Predicted MW 62.5 kDa
Protein Sequence
Protein Sequence
>RC223868 protein sequence
Red=Cloning site Green=Tags(s)

MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVGNTLVCFIVLK
NRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSGLVQGMSVSASVFTLVAIAVE
RFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTLTVTREEHHFMVDARNRSYPLYSCWEAWPEK
GMRRVYTTVLFSHIYLAPLALIVVMYARIARKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFT
LSWLPLWALLLLIDYGQLSAPQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCP
RPSGSHKEAYSERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH
LPLTIPAWDI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_110414
RefSeq Size 2823
RefSeq ORF 1290
Synonyms CFHL5; CFHR5D; FHR-5; FHR5
Locus ID 81494
UniProt ID Q9BXR6
Cytogenetics 1q31.3
Summary This gene is a member of a small complement factor H (CFH) gene cluster on chromosome 1. Each member of this gene family contains multiple short consensus repeats (SCRs) typical of regulators of complement activation. The protein encoded by this gene has nine SCRs with the first two repeats having heparin binding properties, a region within repeats 5-7 having heparin binding and C reactive protein binding properties, and the C-terminal repeats being similar to a complement component 3 b (C3b) binding domain. This protein co-localizes with C3, binds C3b in a dose-dependent manner, and is recruited to tissues damaged by C-reactive protein. Allelic variations in this gene have been associated, but not causally linked, with two different forms of kidney disease: membranoproliferative glomerulonephritis type II (MPGNII) and hemolytic uraemic syndrome (HUS). provided by RefSeq, Jan 2010
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CFHR5" proteins (3)
SKU Description Size Price
LC410709 Lyophilized CFHR5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410709 Transient overexpression lysate of complement factor H-related 5 (CFHR5) (as WB positive control) 100 ug
$665.00
TP323868 Recombinant protein of human complement factor H-related 5 (CFHR5), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products