OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BTN1A1 (NM_001732) Human Mass Spec Standard

Be the first to review this product
SKU
PH323852
BTN1A1 MS Standard C13 and N15-labeled recombinant protein (NP_001723)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501529 BTN1A1 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5) 100 ul
$447.00
LY400653 Transient overexpression lysate of butyrophilin, subfamily 1, member A1 (BTN1A1) (as WB positive control) 100 ug
$665.00

Other products for "BTN1A1 or NM_001732"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223852
Predicted MW 58.8 kDa
Protein Sequence
Protein Sequence
>RC223852 representing NM_001732
Red=Cloning site Green=Tags(s)

MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKV
SPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLK
VAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRD
TSTKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERR
NEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGR
ETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR
RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQD
LSKEIPLSPMGEESAPRDADTLHSKLIPTQPSQGAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001723
RefSeq Size 2901
RefSeq ORF 1578
Synonyms BT; BTN; BTN1
Locus ID 696
UniProt ID Q13410
Cytogenetics 6p22.2
Summary Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BTN1A1" proteins (4)
SKU Description Size Price
LC400653 Lyophilized BTN1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400653 Transient overexpression lysate of butyrophilin, subfamily 1, member A1 (BTN1A1) (as WB positive control) 100 ug
$665.00
TP323852 Recombinant protein of human butyrophilin, subfamily 1, member A1 (BTN1A1), 20 µg 20 ug
$867.00
TP720427 Recombinant protein of human butyrophilin, subfamily 1, member A1 (BTN1A1) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products