TMIGD1 (NM_206832) Human Mass Spec Standard

CAT#: PH323761

TMIGD1 MS Standard C13 and N15-labeled recombinant protein (NP_996663)

Product Images

Coomassie blue staining of purified TMIGD1 protein (Cat# TP323761). The protein was produced from HEK293T cells transfected with TMIGD1 cDNA clone (Cat# RC223761) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223761
• Predicted MW: 29 kDa
• Protein Sequence:
  Sequence Link

  >RC223761 representing NM_206832
  Red=Cloning site Green=Tags(s)
  
  MAWKSSVIMQMGRFLLLVILFLPREMTSSVLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYRE
  EGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVK
  LVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHL
  IVKDKTVGVPIEPIIAACVVIFLTLCFGLIARRKKIMKLCMKDKDPHSETAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_996663
• RefSeq Size: 1201
• RefSeq ORF: 786
• Synonyms: TMIGD; UNQ9372
• Locus ID: 388364
• UniProt ID: Q6UXZ0
• Cytogenetics: 17q11.2
• Summary: May control cell-cell adhesion, cell migration and proliferation, cell morphology, and protects renal epithelial cells from oxidative cell injury to promote cell survival.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane