OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC83 (NM_173556) Human Mass Spec Standard

Be the first to review this product
SKU
PH323659
CCDC83 MS Standard C13 and N15-labeled recombinant protein (NP_775827)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308610 Rabbit Polyclonal antibody to CCDC83 (coiled-coil domain containing 83)
100 ul
$665.00
LY406467 Transient overexpression lysate of coiled-coil domain containing 83 (CCDC83) (as WB positive control) 100 ug
$665.00

Other products for "CCDC83 or NM_173556"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223659
Predicted MW 52.2 kDa
Protein Sequence
Protein Sequence
>RC223659 representing NM_173556
Red=Cloning site Green=Tags(s)

MENSGKANKKDTHDGPPKEIKLPTSEALLDYQCQIKEDAVEQFMFQIKTLRKKNQKYHERNSRLKEEQIW
HIRHLLKELSEEKAEGLPVVTREDVEEAMKEKWKFERDQEKNLRDMRMQISNAEKLFLEKLSEKEYWEEY
KNVGSERHAKLITSLQNDINTVKENAEKMSEHYKITLEDTRKKIIKETLLQLDQKKEWATQNAVKLIDKG
SYLEIWENDWLKKEVAIHRKEVEELKNAIHELEAENLVLIDQLSNCRLVDLKIPRYPVLHSCPTSNPRHL
LLLPLESCLISARRCWRLYLTQAAGLEVPPEEMSLELPETHIEEKSELQPTEVESRDLMSSSDESTILHL
SHENSIEDLQYVKIDKEENSGTEFGDTDMKYLLYEDEKDFKDYVNLGPLGVKLMSVESKKMPIHFQEKEI
PVKLYKDVRSPESHITYKMMKSFL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775827
RefSeq Size 2346
RefSeq ORF 1332
Synonyms CT148; HSD9; KP-CoT-23
Locus ID 220047
UniProt ID Q8IWF9
Cytogenetics 11q14.1-q14.2
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC83" proteins (3)
SKU Description Size Price
LC406467 Lyophilized CCDC83 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406467 Transient overexpression lysate of coiled-coil domain containing 83 (CCDC83) (as WB positive control) 100 ug
$665.00
TP323659 Recombinant protein of human coiled-coil domain containing 83 (CCDC83), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products