OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LYG2 (NM_175735) Human Mass Spec Standard

Be the first to review this product
SKU
PH323549
LYG2 MS Standard C13 and N15-labeled recombinant protein (NP_783862)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA357773 LYG2 Antibody - N-terminal region
100 ul
$585.00
LY406247 Transient overexpression lysate of lysozyme G-like 2 (LYG2) (as WB positive control) 100 ug
$436.00

Other products for "LYG2 or NM_175735"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223549
Predicted MW 23.5 kDa
Protein Sequence
Protein Sequence
>RC223549 protein sequence
Red=Cloning site Green=Tags(s)

MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFA
EMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWD
SKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQ
SF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_783862
RefSeq Size 880
RefSeq ORF 636
Synonyms LYGA2; LYGH; LYSG2
Locus ID 254773
UniProt ID Q86SG7
Cytogenetics 2q11.2
Summary The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc). provided by RefSeq, Jul 2008
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LYG2" proteins (3)
SKU Description Size Price
LC406247 Lyophilized LYG2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406247 Transient overexpression lysate of lysozyme G-like 2 (LYG2) (as WB positive control) 100 ug
$436.00
TP323549 Recombinant protein of human lysozyme G-like 2 (LYG2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products