OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

YY2 (NM_206923) Human Mass Spec Standard

Be the first to review this product
SKU
PH323433
YY2 MS Standard C13 and N15-labeled recombinant protein (NP_996806)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA383427 YY2 Rabbit polyclonal Antibody
100 ul
$410.00
LY404172 Transient overexpression lysate of YY2 transcription factor (YY2) (as WB positive control) 100 ug
$436.00

Other products for "YY2 or NM_206923"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223433
Predicted MW 41.2 kDa
Protein Sequence
Protein Sequence
>RC223433 representing NM_206923
Red=Cloning site Green=Tags(s)

MASNEDFSTTQDLEIPADIVELHDINVEPLPMEDIPTESVQYEDVDGNWIYGGHNHPPLMVLQPLFTNTG
YGDHDQEMLMLQTQEEVVGYCDSDNQLGNDLEDQLALPDSIEDEHFQMTLASLSASAASTSTSTQSRSKK
PSKRPSGKSATSTEANPAGSSSSLGTRKWEQKQMQVKTLEGEFSVTMWSPNDNNDQGAVGEGQAENPPDY
SEYLKGKKLPPGGLPGIDLSDPKQLAEFTKVKPKRSKGEPPKTVPCSYSGCEKMFRDYAAMRKHLHIHGP
RVHVCAECGKAFLESSKLRRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHLRIHTGDKPFVCPFDVCNR
KFAQSTNLKTHILTHVKTKNNP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996806
RefSeq Size 1119
RefSeq ORF 1116
Synonyms ZNF631
Locus ID 404281
UniProt ID O15391
Cytogenetics Xp22.12
Summary The protein encoded by this gene is a transcription factor that includes several Kruppel-like zinc fingers in its C-terminal region. It possesses both activation and repression domains, and it can therefore have both positive and negative effects on the transcription of target genes. This gene has an intronless coding region, and it appears to have arisen by retrotransposition of the related YY1 transcription factor gene, which is located on chromosome 14. provided by RefSeq, May 2010
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "YY2" proteins (3)
SKU Description Size Price
LC404172 Lyophilized YY2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404172 Transient overexpression lysate of YY2 transcription factor (YY2) (as WB positive control) 100 ug
$436.00
TP323433 Purified recombinant protein of Homo sapiens YY2 transcription factor (YY2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products