OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXC2 (NM_005251) Human Mass Spec Standard

Be the first to review this product
SKU
PH323412
FOXC2 MS Standard C13 and N15-labeled recombinant protein (NP_005242)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA807700 FOXC2 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3) 100 ul
$447.00
LY401613 Transient overexpression lysate of forkhead box C2 (MFH-1, mesenchyme forkhead 1) (FOXC2) (as WB positive control) 100 ug
$665.00

Other products for "FOXC2 or NM_005251"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223412
Predicted MW 53.5 kDa
Protein Sequence
Protein Sequence
>RC223412 representing NM_005251
Red=Cloning site Green=Tags(s)

MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDL
VKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKP
GKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKK
VVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRT
SPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCV
PPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQ
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRH
AAPYSYDCTKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005242
RefSeq Size 1506
RefSeq ORF 1503
Synonyms FKHL14; LD; MFH-1; MFH1
Locus ID 2303
UniProt ID Q99958
Cytogenetics 16q24.1
Summary This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXC2" proteins (4)
SKU Description Size Price
LC401613 Lyophilized FOXC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401613 Transient overexpression lysate of forkhead box C2 (MFH-1, mesenchyme forkhead 1) (FOXC2) (as WB positive control) 100 ug
$665.00
TP323412 Recombinant protein of human forkhead box C2 (MFH-1, mesenchyme forkhead 1) (FOXC2), 20 µg 20 ug
$737.00
TP760662 Purified recombinant protein of Human forkhead box C2 (MFH-1, mesenchyme forkhead 1) (FOXC2), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products