OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXD4L1 (NM_012184) Human Mass Spec Standard

Be the first to review this product
SKU
PH323243
FOXD4L1 MS Standard C13 and N15-labeled recombinant protein (NP_036316)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316217 Rabbit polyclonal anti-FOXD4L1 antibody
100 ul
$380.00
LY415931 Transient overexpression lysate of forkhead box D4-like 1 (FOXD4L1) (as WB positive control) 100 ug
$436.00

Other products for "FOXD4L1 or NM_012184"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223243
Predicted MW 43.4 kDa
Protein Sequence
Protein Sequence
>RC223243 representing NM_012184
Red=Cloning site Green=Tags(s)

MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQVARWGGVALP
REHIEGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGR
FPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNGSFLRRRKRFKRHQLTP
GAHLPHPFPLPAAHAALHNPRPGPLLGAPALPQPVPGAYPNTAPGRRPYALLHPHPPRYLLLSAPAYAGA
PKKAEGADLATPGTLPVLQPSLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWS
YCPLLQRPSSLSDNFAATAAASGGGLRQRLRSHQGRGAGRAPVGRVGAAAVSGGGRGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036316
RefSeq Size 2250
RefSeq ORF 1224
Synonyms bA395L14.1; FOXD5
Locus ID 200350
UniProt ID Q9NU39
Cytogenetics 2q14.1
Summary This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXD4L1" proteins (3)
SKU Description Size Price
LC415931 Lyophilized FOXD4L1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415931 Transient overexpression lysate of forkhead box D4-like 1 (FOXD4L1) (as WB positive control) 100 ug
$436.00
TP323243 Recombinant protein of human forkhead box D4-like 1 (FOXD4L1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products