OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MLX (NM_198205) Human Mass Spec Standard

Be the first to review this product
SKU
PH323064
MLX MS Standard C13 and N15-labeled recombinant protein (NP_937848)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810951 MLX mouse monoclonal antibody,clone OTI1D11 100 ul
$447.00
LY406915 Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "MLX or NM_198205"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223064
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC223064 representing NM_198205
Red=Cloning site Green=Tags(s)

MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQT
IVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQD
NPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLK
NQLY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_937848
RefSeq Size 2316
RefSeq ORF 642
Synonyms bHLHd13; MAD7; MXD7; TCFL4; TF4
Locus ID 6945
UniProt ID Q9UH92
Cytogenetics 17q21.2
Summary The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MLX" proteins (9)
SKU Description Size Price
PH301911 MLX MS Standard C13 and N15-labeled recombinant protein (NP_937847) 10 ug
$3,360.00
LC404977 Lyophilized MLX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404978 Lyophilized MLX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406915 Lyophilized MLX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404977 Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404978 Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY406915 Transient overexpression lysate of MAX-like protein X (MLX), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP301911 Recombinant protein of human MAX-like protein X (MLX), transcript variant 2, 20 µg 20 ug
$867.00
TP323064 Purified recombinant protein of Homo sapiens MAX-like protein X (MLX), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products