S100A7L2 (NM_001045479) Human Mass Spec Standard

CAT#: PH323024

S100A7L2 MS Standard C13 and N15-labeled recombinant protein (NP_001038944)

Product images

Coomassie blue staining of purified S100A7L2 protein (Cat# TP323024). The protein was produced from HEK293T cells transfected with S100A7L2 cDNA clone (Cat# RC223024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Description: S100A7L2 MS Standard C13 and N15-labeled recombinant protein (NP_001038944)
• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223024
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223024 representing NM_001045479
  Red=Cloning site Green=Tags(s)
  
  MLPSSGFLKAKMNIPLGEKVMLDIVAMFRQYSGDDGRMDMPGLVNLMKENFPNFLSGCEKSDMDYLSNAL
  EKKDDNKDKKVNYSEFLSLLGDITIDHHKIMHGVAPCSGGSQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001038944
• RefSeq Size: 480
• RefSeq ORF: 336
• Synonyms: S100a7b
• Locus ID: 645922
• Cytogenetics: 1q21.3
• Summary: This locus is currently categorized as a non-transcribed pseudogene, but the locus type of this gene is unclear since it does contain an intact CDS. This locus lacks evidence indicating that it is transcribed, and very little of the upstream regions found in other family members are present at this locus. [provided by RefSeq, May 2018]