OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USF2 (NM_207291) Human Mass Spec Standard

Be the first to review this product
SKU
PH323006
USF2 MS Standard C13 and N15-labeled recombinant protein (NP_997174)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA314665 Rabbit polyclonal anti-USF2 antibody
100 ul
$380.00
LY404074 Transient overexpression lysate of upstream transcription factor 2, c-fos interacting (USF2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "USF2 or NM_207291"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223006
Predicted MW 30.4 kDa
Protein Sequence
Protein Sequence
>RC223006 representing NM_207291
Red=Cloning site Green=Tags(s)

MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRT
ETNGGQAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQ
TGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKG
GILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997174
RefSeq Size 1531
RefSeq ORF 837
Synonyms bHLHb12; FIP
Locus ID 7392
UniProt ID Q15853
Cytogenetics 19q13.12
Summary This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multiple cellular processes. provided by RefSeq, Mar 2016
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USF2" proteins (5)
SKU Description Size Price
LC404074 Lyophilized USF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC418723 Lyophilized USF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404074 Transient overexpression lysate of upstream transcription factor 2, c-fos interacting (USF2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY418723 Transient overexpression lysate of upstream transcription factor 2, c-fos interacting (USF2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP323006 Purified recombinant protein of Homo sapiens upstream transcription factor 2, c-fos interacting (USF2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products