OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FSH beta (FSHB) (NM_000510) Human Mass Spec Standard

Be the first to review this product
SKU
PH322666
FSHB MS Standard C13 and N15-labeled recombinant protein (NP_000501)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY400397 Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "FSH beta or NM_000510"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222666
Predicted MW 14.7 kDa
Protein Sequence
Protein Sequence
>RC222666 protein sequence
Red=Cloning site Green=Tags(s)

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT
FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000501
RefSeq Size 1936
RefSeq ORF 387
Synonyms HH24
Locus ID 2488
UniProt ID P01225
Cytogenetics 11p14.1
Summary The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway, Neuroactive ligand-receptor interaction
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FSH beta" proteins (8)
SKU Description Size Price
PH314616 FSHB MS Standard C13 and N15-labeled recombinant protein (NP_001018090) 10 ug
$3,360.00
LC400397 Lyophilized FSHB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424668 Lyophilized FSHB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400397 Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424668 Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP314616 Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, 20 µg 20 ug
$737.00
TP322666 Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1, 20 µg 20 ug
$737.00
TP701085 Purified recombinant protein of Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, Asn19-end, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products