FSH beta (FSHB) (NM_000510) Human Recombinant Protein

SKU
TP322666
Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC222666 protein sequence
Red=Cloning site Green=Tags(s)

MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCT
FKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000501
Locus ID 2488
UniProt ID P01225
Cytogenetics 11p14.1
RefSeq Size 1936
RefSeq ORF 387
Synonyms HH24
Summary The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway, Neuroactive ligand-receptor interaction
Write Your Own Review
You're reviewing:FSH beta (FSHB) (NM_000510) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314616 FSHB MS Standard C13 and N15-labeled recombinant protein (NP_001018090) 10 ug
$3,255.00
PH322666 FSHB MS Standard C13 and N15-labeled recombinant protein (NP_000501) 10 ug
$3,255.00
LC400397 FSHB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424668 FSHB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400397 Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2 100 ug
$436.00
LY424668 Transient overexpression lysate of follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 1 100 ug
$436.00
TP314616 Recombinant protein of human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, 20 µg 20 ug
$737.00
TP701085 Purified recombinant protein of Human follicle stimulating hormone, beta polypeptide (FSHB), transcript variant 2, Asn19-end, with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.