OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPINT4 (NM_178455) Human Mass Spec Standard

Be the first to review this product
SKU
PH322419
SPINT4 MS Standard C13 and N15-labeled recombinant protein (NP_848550)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Other products for "SPINT4 or NM_178455"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222419
Predicted MW 11.2 kDa
Protein Sequence
Protein Sequence
>RC222419 representing NM_178455
Red=Cloning site Green=Tags(s)

MKSAKLGFLLRFFIFCSLNTLLLGGVNKIAEKICGDLKDPCKLDMNFGSCYEVHFRYFYNRTSKRCETFV
FSGCNGNLNNFKLKIEREVACVAKYKPPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_848550
RefSeq Size 380
RefSeq ORF 297
Synonyms C20orf137; dJ601O1.1; SPINT3
Locus ID 391253
UniProt ID Q6UDR6
Cytogenetics 20q13.12
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPINT4" proteins (1)
SKU Description Size Price
TP322419 Purified recombinant protein of Homo sapiens serine peptidase inhibitor, Kunitz type 4 (SPINT4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products