OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF146 (NM_007145) Human Mass Spec Standard

Be the first to review this product
SKU
PH322413
ZNF146 MS Standard C13 and N15-labeled recombinant protein (NP_009076)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351976 Rabbit Polyclonal Anti-ZNF146 Antibody
100 ul
$205.00
LY416151 Transient overexpression lysate of zinc finger protein 146 (ZNF146), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ZNF146 or NM_007145"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222413
Predicted MW 33.1 kDa
Protein Sequence
Protein Sequence
>RC222413 representing NM_007145
Red=Cloning site Green=Tags(s)

MSHLSQQKIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEK
LFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGK
SNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDK
PYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQK
SHHIRHQKIHTH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009076
RefSeq Size 3186
RefSeq ORF 876
Synonyms OZF
Locus ID 7705
UniProt ID Q15072
Cytogenetics 19q13.12
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF146" proteins (3)
SKU Description Size Price
LC416151 Lyophilized ZNF146 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416151 Transient overexpression lysate of zinc finger protein 146 (ZNF146), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP322413 Recombinant protein of human zinc finger protein 146 (ZNF146), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products