OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PTPDC1 (NM_152422) Human Mass Spec Standard

Be the first to review this product
SKU
PH322339
PTPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_689635)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403467 Transient overexpression lysate of protein tyrosine phosphatase domain containing 1 (PTPDC1), transcript variant 1 (as WB positive control) 100 ug
$665.00

Other products for "PTPDC1 or NM_152422"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC222339
Predicted MW 90 kDa
Protein Sequence
Protein Sequence
>RC222339 representing NM_152422
Red=Cloning site Green=Tags(s)

MQVQDATRRPSAVRFLSSFLQGRRHSTSDPVLRLQQARRGSGLGSGSATKLLSSSSLQVMVAVSSVSHAE
GNPTFPERKRNLERPTPKYTKVGERLRHVIPGHMACSMACGGRACKYENPARWSEQEQAIKGVYSSWVTD
NILAMARPSSELLEKYHIIDQFLSHGIKTIINLQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFG
WKDYGVASLTTILDMVKVMTFALQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAIIFVRAKRPNSI
QTRGQLLCVREFTQFLTPLRNIFSCCDPKAHAVTLPQYLIRQRHLLHGYEARLLKHVPKIIHLVCKLLLD
LAENRPVMMKDVSEGPGLSAEIEKTMSEMVTMQLDKELLRHDSDVSNPPNPTAVAADFDNRGMIFSNEQQ
FDPLWKRRNVECLQPLTHLKRRLSYSDSDLKRAENLLEQGETPQTVPAQILVGHKPRQQKLISHCYIPQS
PEPDLHKEALVRSTLSFWSQSKFGGLEGLKDNGSPIFHGRIIPKEAQQSGAFSADVSGSHSPGEPVSPSF
ANVHKDPNPAHQQVSHCQCKTHGVGSPGSVRQNSRTPRSPLDCGSSPKAQFLVEHETQDSKDLSEAASHS
ALQSELSAEARRILAAKALANLNESVEKEELKRKVEMWQKELNSRDGAWERICGERDPFILCSLMWSWVE
QLKEPVITKEDVDMLVDRRADAAEALFLLEKGQHQTILCVLHCIVNLQTIPVDVEEAFLAHAIKAFTKVN
FDSENGPTVYNTLKKIFKHTLEEKRKMTKDGPKPGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689635
RefSeq Size 4398
RefSeq ORF 2418
Synonyms PTP9Q22
Locus ID 138639
UniProt ID A2A3K4
Cytogenetics 9q22.32
Summary The protein encoded by this gene contains a characteristic motif of protein tyrosine phosphatases (PTPs). PTPs regulate activities of phosphoproteins through dephosphorylation. They are signaling molecules involved in the regulation of a wide variety of biological processes. The specific function of this protein has not yet been determined. Alternatively spliced transcript variants encoding distinct isoforms have been identified. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PTPDC1" proteins (7)
SKU Description Size Price
PH308971 PTPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_818931) 10 ug
$3,360.00
LC403467 Lyophilized PTPDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405883 Lyophilized PTPDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403467 Transient overexpression lysate of protein tyrosine phosphatase domain containing 1 (PTPDC1), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY405883 Transient overexpression lysate of protein tyrosine phosphatase domain containing 1 (PTPDC1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP308971 Recombinant protein of human protein tyrosine phosphatase domain containing 1 (PTPDC1), transcript variant 2, 20 µg 20 ug
$867.00
TP322339 Recombinant protein of human protein tyrosine phosphatase domain containing 1 (PTPDC1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products